| Name | C2ORF29 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3470 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | C2ORF29 antibody was raised using the middle region of C2Orf29 corresponding to a region with amino acids SVDISGLQLALAERQSELPTQSKASFPSILSDPDPDSSNSGFDSSVASQI |
| Purity/Format | Affinity purified |
| Blocking Peptide | C2ORF29 Blocking Peptide |
| Description | Rabbit polyclonal C2ORF29 antibody raised against the middle region of C2Orf29 |
| Gene | CNOT11 |
| Supplier Page | Shop |