| Name | PRKAB2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3694 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | PRKAB2 antibody was raised using the middle region of PRKAB2 corresponding to a region with amino acids RDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPA |
| Purity/Format | Affinity purified |
| Blocking Peptide | PRKAB2 Blocking Peptide |
| Description | Rabbit polyclonal PRKAB2 antibody raised against the middle region of PRKAB2 |
| Gene | PRKAB2 |
| Supplier Page | Shop |