Name | MMP20 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-7198 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | MMP20 antibody was raised using the middle region of MMP20 corresponding to a region with amino acids AAVYLREPQKTLFFVGDEYYSYDERKRKMEKDYPKNTEEEFSGVNGQIDA |
Purity/Format | Affinity purified |
Blocking Peptide | MMP20 Blocking Peptide |
Description | Rabbit polyclonal MMP20 antibody raised against the middle region of MMP20 |
Gene | MMP20 |
Supplier Page | Shop |