SLC35D3 antibody

Name SLC35D3 antibody
Supplier Fitzgerald
Catalog 70R-6652
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen SLC35D3 antibody was raised using the N terminal of SLC35D3 corresponding to a region with amino acids RYQFSFLTLVQCLTSSTAALSLELLRRLGLIAVPPFGLSLARSFAGVAVL
Purity/Format Affinity purified
Blocking Peptide SLC35D3 Blocking Peptide
Description Rabbit polyclonal SLC35D3 antibody raised against the N terminal of SLC35D3
Gene SLC35D3
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.