| Name | EPRS antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3534 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | EPRS antibody was raised using the middle region of EPRS corresponding to a region with amino acids GKIVQIPFCGEIDCEDWIKKTTARDQDLEPGAPSMGAKSLCIPFKPLCEL |
| Purity/Format | Affinity purified |
| Blocking Peptide | EPRS Blocking Peptide |
| Description | Rabbit polyclonal EPRS antibody raised against the middle region of EPRS |
| Gene | EPRS |
| Supplier Page | Shop |