Name | FAM134C antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-7038 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | FAM134C antibody was raised using the N terminal of FAM134C corresponding to a region with amino acids EAAQRALVEVLGPYEPLLSRVQAALVWERPARSALWCLGLNAAFWFFALT |
Purity/Format | Affinity purified |
Blocking Peptide | FAM134C Blocking Peptide |
Description | Rabbit polyclonal FAM134C antibody raised against the N terminal of FAM134C |
Gene | FAM134C |
Supplier Page | Shop |