| Name | MCM9 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5552 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | MCM9 antibody was raised using the N terminal of MCM9 corresponding to a region with amino acids NSDQVTLVGQVFESYVSEYHKNDILLILKERDEDAHYPVVVNAMTLFETN |
| Purity/Format | Affinity purified |
| Blocking Peptide | MCM9 Blocking Peptide |
| Description | Rabbit polyclonal MCM9 antibody raised against the N terminal of MCM9 |
| Gene | MCM9 |
| Supplier Page | Shop |