| Name | Annexin A7 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1680 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Annexin A7 antibody was raised using the N terminal of ANXA7 corresponding to a region with amino acids GGQMPSQYPGGQPTYPSQPATVTQVTQGTIRPAANFDAIRDAEILRKAMK |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | Annexin A7 Blocking Peptide |
| Description | Rabbit polyclonal Annexin A7 antibody raised against the N terminal of ANXA7 |
| Gene | ANXA7 |
| Supplier Page | Shop |