Name | CPEB2 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-4851 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | CPEB2 antibody was raised using the N terminal of CPEB2 corresponding to a region with amino acids FLQQRNSYNHHQPLLKQSPWSNHQSSGWGTGSMSWGAMHGRDHRRTGNMG |
Purity/Format | Affinity purified |
Blocking Peptide | CPEB2 Blocking Peptide |
Description | Rabbit polyclonal CPEB2 antibody raised against the N terminal of CPEB2 |
Gene | CPEB2 |
Supplier Page | Shop |