| Name | CPEB2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4851 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | CPEB2 antibody was raised using the N terminal of CPEB2 corresponding to a region with amino acids FLQQRNSYNHHQPLLKQSPWSNHQSSGWGTGSMSWGAMHGRDHRRTGNMG |
| Purity/Format | Affinity purified |
| Blocking Peptide | CPEB2 Blocking Peptide |
| Description | Rabbit polyclonal CPEB2 antibody raised against the N terminal of CPEB2 |
| Gene | CPEB2 |
| Supplier Page | Shop |