AKAP7 antibody

Name AKAP7 antibody
Supplier Fitzgerald
Catalog 70R-2673
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen AKAP7 antibody was raised using a synthetic peptide corresponding to a region with amino acids MGQLCCFPFSRDEGKISELESSSSAVLQRYSKDIPSWSSGEKNGGEPDDA
Purity/Format Affinity purified
Blocking Peptide AKAP7 Blocking Peptide
Description Rabbit polyclonal AKAP7 antibody
Gene AKAP7
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.