| Name | NXF5 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1358 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | NXF5 antibody was raised using the middle region of NXF5 corresponding to a region with amino acids ITERNFPELLSLNLCNNKLYQLDGLSDITEKAPKVKTLNLSKNKLESAWE |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | NXF5 Blocking Peptide |
| Description | Rabbit polyclonal NXF5 antibody raised against the middle region of NXF5 |
| Gene | NXF5 |
| Supplier Page | Shop |