HS6ST3 antibody

Name HS6ST3 antibody
Supplier Fitzgerald
Catalog 70R-7460
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen HS6ST3 antibody was raised using the C terminal of HS6ST3 corresponding to a region with amino acids TKQLEHQRDRQKRREERRLQREHRDHQWPKEDGAAEGTVTEDYNSQVVRW
Purity/Format Affinity purified
Blocking Peptide HS6ST3 Blocking Peptide
Description Rabbit polyclonal HS6ST3 antibody raised against the C terminal of HS6ST3
Gene HS6ST3
Supplier Page Shop