Name | FTHL17 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6913 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | FTHL17 antibody was raised using the N terminal of FTHL17 corresponding to a region with amino acids MAFYFNRDDVALENFFRYFLRLSDDKMEHAQKLMRLQNLRGGHICLHDIR |
Purity/Format | Affinity purified |
Blocking Peptide | FTHL17 Blocking Peptide |
Description | Rabbit polyclonal FTHL17 antibody raised against the N terminal of FTHL17 |
Gene | FTHL17 |
Supplier Page | Shop |