| Name | FTHL17 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6913 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | FTHL17 antibody was raised using the N terminal of FTHL17 corresponding to a region with amino acids MAFYFNRDDVALENFFRYFLRLSDDKMEHAQKLMRLQNLRGGHICLHDIR |
| Purity/Format | Affinity purified |
| Blocking Peptide | FTHL17 Blocking Peptide |
| Description | Rabbit polyclonal FTHL17 antibody raised against the N terminal of FTHL17 |
| Gene | FTHL17 |
| Supplier Page | Shop |