| Name | AMT antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2513 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | AMT antibody was raised using the N terminal of AMT corresponding to a region with amino acids QRAVSVVARLGFRLQAFPPALCRPLSCAQEVLRRTPLYDFHLAHGGKMVA |
| Purity/Format | Affinity purified |
| Blocking Peptide | AMT Blocking Peptide |
| Description | Rabbit polyclonal AMT antibody raised against the N terminal of AMT |
| Gene | GCSH |
| Supplier Page | Shop |