Name | WBP2NL antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-2416 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | WBP2NL antibody was raised using the N terminal of WBP2NL corresponding to a region with amino acids MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSEGSNVFSGRKTGT |
Purity/Format | Affinity purified |
Blocking Peptide | WBP2NL Blocking Peptide |
Description | Rabbit polyclonal WBP2NL antibody raised against the N terminal of WBP2NL |
Gene | WBP2NL |
Supplier Page | Shop |