| Name | WBP2NL antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2416 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | WBP2NL antibody was raised using the N terminal of WBP2NL corresponding to a region with amino acids MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSEGSNVFSGRKTGT |
| Purity/Format | Affinity purified |
| Blocking Peptide | WBP2NL Blocking Peptide |
| Description | Rabbit polyclonal WBP2NL antibody raised against the N terminal of WBP2NL |
| Gene | WBP2NL |
| Supplier Page | Shop |