| Name | BDNF antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6209 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | BDNF antibody was raised using the middle region of BDNF corresponding to a region with amino acids EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
| Purity/Format | Affinity purified |
| Blocking Peptide | BDNF Blocking Peptide |
| Description | Rabbit polyclonal BDNF antibody raised against the middle region of BDNF |
| Gene | BDNF-AS |
| Supplier Page | Shop |