| Name | KIF25 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1615 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | KIF25 antibody was raised using the C terminal of KIF25 corresponding to a region with amino acids VLGALLEHRGHAPYRNSRLTHLLQDCLGGDAKLLVILCISPSQRHLAQTL |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | KIF25 Blocking Peptide |
| Description | Rabbit polyclonal KIF25 antibody raised against the C terminal of KIF25 |
| Gene | KIF25 |
| Supplier Page | Shop |