| Name | CAMLG antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2352 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | CAMLG antibody was raised using the N terminal of CAMLG corresponding to a region with amino acids LLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDSDKLNSLSVPSVSKRV |
| Purity/Format | Affinity purified |
| Blocking Peptide | CAMLG Blocking Peptide |
| Description | Rabbit polyclonal CAMLG antibody raised against the N terminal of CAMLG |
| Gene | CAMLG |
| Supplier Page | Shop |