| Name | GLUT12 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6946 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | GLUT12 antibody was raised using a synthetic peptide corresponding to a region with amino acids FFVQITGQPNILFYASTVLKSVGFQSNEAASLASTGVGVVKVISTIPATL |
| Purity/Format | Affinity purified |
| Blocking Peptide | GLUT12 Blocking Peptide |
| Description | Rabbit polyclonal GLUT12 antibody |
| Gene | SLC2A12 |
| Supplier Page | Shop |