| Name | CRELD1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1808 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Dog |
| Antigen | CRELD1 antibody was raised using the C terminal of CRELD1 corresponding to a region with amino acids TEVCPGENKQCENTEGGYRCICAEGYKQMEGICVKEQIPESAGFFSEMTE |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | CRELD1 Blocking Peptide |
| Description | Rabbit polyclonal CRELD1 antibody raised against the C terminal of CRELD1 |
| Gene | CRELD1 |
| Supplier Page | Shop |