SPOCK3 antibody

Name SPOCK3 antibody
Supplier Fitzgerald
Catalog 70R-6593
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse
Antigen SPOCK3 antibody was raised using a synthetic peptide corresponding to a region with amino acids CPCPSDKPTSTSRNVKRACSDLEFREVANRLRDWFKALHESGSQNKKTKT
Purity/Format Affinity purified
Blocking Peptide SPOCK3 Blocking Peptide
Description Rabbit polyclonal SPOCK3 antibody
Gene SPOCK3
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.