Name | C20ORF141 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3827 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | C20ORF141 antibody was raised using the middle region of C20Orf141 corresponding to a region with amino acids RKLLTRGQSQGAGEGPGQQEALLLQMGTVSGQLSLQDALLLLLMGLGPLL |
Purity/Format | Affinity purified |
Blocking Peptide | C20ORF141 Blocking Peptide |
Description | Rabbit polyclonal C20ORF141 antibody raised against the middle region of C20Orf141 |
Gene | C20orf141 |
Supplier Page | Shop |