Name | ST3GAL4 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-7331 |
Prices | $375.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | ST3GAL4 antibody was raised using the middle region of ST3GAL4 corresponding to a region with amino acids IKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSM |
Purity/Format | Affinity purified |
Blocking Peptide | ST3GAL4 Blocking Peptide |
Description | Rabbit polyclonal ST3GAL4 antibody raised against the middle region of ST3GAL4 |
Gene | ST3GAL4 |
Supplier Page | Shop |