| Name | ST3GAL4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7331 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | ST3GAL4 antibody was raised using the middle region of ST3GAL4 corresponding to a region with amino acids IKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSM |
| Purity/Format | Affinity purified |
| Blocking Peptide | ST3GAL4 Blocking Peptide |
| Description | Rabbit polyclonal ST3GAL4 antibody raised against the middle region of ST3GAL4 |
| Gene | ST3GAL4 |
| Supplier Page | Shop |