| Name | PB antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2192 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Drosophila |
| Antigen | PB antibody was raised using the middle region of Pb corresponding to a region with amino acids DLTERQVKVWFQNRRMKHKRQTLSKTDDEDNKDSLKGDDDQSDSNSNSKK |
| Purity/Format | Affinity purified |
| Blocking Peptide | PB Blocking Peptide |
| Description | Rabbit polyclonal PB antibody raised against the middle region of Pb |
| Gene | pd |
| Supplier Page | Shop |