| Name | GEM antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1647 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | GEM antibody was raised using the C terminal of GEM corresponding to a region with amino acids FSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKL |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | GEM Blocking Peptide |
| Description | Rabbit polyclonal GEM antibody raised against the C terminal of GEM |
| Gene | KIR3DL1 |
| Supplier Page | Shop |