Name | GEM antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1647 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | IHC WB |
Species Reactivities | Human, Mouse, Rat, Dog |
Antigen | GEM antibody was raised using the C terminal of GEM corresponding to a region with amino acids FSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKL |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | GEM Blocking Peptide |
Description | Rabbit polyclonal GEM antibody raised against the C terminal of GEM |
Gene | KIR3DL1 |
Supplier Page | Shop |