| Name | TRPC4AP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5845 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | TRPC4AP antibody was raised using the middle region of TRPC4AP corresponding to a region with amino acids GASEENGLPHTSARTQLPQSMKIMHEIMYKLEVLYVLCVLLMGRQRNQVH |
| Purity/Format | Affinity purified |
| Blocking Peptide | TRPC4AP Blocking Peptide |
| Description | Rabbit polyclonal TRPC4AP antibody raised against the middle region of TRPC4AP |
| Gene | TRPC4AP |
| Supplier Page | Shop |