SC5DL antibody

Name SC5DL antibody
Supplier Fitzgerald
Catalog 70R-6978
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen SC5DL antibody was raised using a synthetic peptide corresponding to a region with amino acids NQVRREIKFTVQALPWISILTVALFLLEIRGYSKLHDDLGEFPYGLFELV
Purity/Format Affinity purified
Blocking Peptide SC5DL Blocking Peptide
Description Rabbit polyclonal SC5DL antibody
Gene SC5D
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.