| Name | MDM1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6273 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | MDM1 antibody was raised using the N terminal of MDM1 corresponding to a region with amino acids GLRSDQLGITKEPSFISKRRVPYHDPQISKSLEWNGAISESNVVASPEPE |
| Purity/Format | Affinity purified |
| Blocking Peptide | MDM1 Blocking Peptide |
| Description | Rabbit polyclonal MDM1 antibody raised against the N terminal of MDM1 |
| Gene | MDM1 |
| Supplier Page | Shop |