| Name | POLR2K antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2961 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | POLR2K antibody was raised using the middle region of POLR2K corresponding to a region with amino acids DTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKR |
| Purity/Format | Affinity purified |
| Blocking Peptide | POLR2K Blocking Peptide |
| Description | Rabbit polyclonal POLR2K antibody raised against the middle region of POLR2K |
| Gene | POLR2K |
| Supplier Page | Shop |