| Name | SF4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4979 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | SF4 antibody was raised using the middle region of SF4 corresponding to a region with amino acids TFKALKEGREPDYSEYKEFKLTVENIGYQMLMKMGWKEGEGLGSEGQGIK |
| Purity/Format | Affinity purified |
| Blocking Peptide | SF4 Blocking Peptide |
| Description | Rabbit polyclonal SF4 antibody raised against the middle region of SF4 |
| Gene | RBP4 |
| Supplier Page | Shop |