| Name | KIAA0157 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3154 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | KIAA0157 antibody was raised using the middle region of Kiaa0157 corresponding to a region with amino acids FAAEGRSTLGDAEASDPPPPYSDFHPNNQESTLSHSRMERSVFMPRPQAV |
| Purity/Format | Affinity purified |
| Blocking Peptide | KIAA0157 Blocking Peptide |
| Description | Rabbit polyclonal KIAA0157 antibody raised against the middle region of Kiaa0157 |
| Gene | FAM175B |
| Supplier Page | Shop |