Name | KIAA0157 antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3154 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | KIAA0157 antibody was raised using the middle region of Kiaa0157 corresponding to a region with amino acids FAAEGRSTLGDAEASDPPPPYSDFHPNNQESTLSHSRMERSVFMPRPQAV |
Purity/Format | Affinity purified |
Blocking Peptide | KIAA0157 Blocking Peptide |
Description | Rabbit polyclonal KIAA0157 antibody raised against the middle region of Kiaa0157 |
Gene | FAM175B |
Supplier Page | Shop |