Granzyme K antibody

Name Granzyme K antibody
Supplier Fitzgerald
Catalog 70R-7203
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Granzyme K antibody was raised using a synthetic peptide corresponding to a region with amino acids PTVVLGAHSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAK
Purity/Format Affinity purified
Blocking Peptide Granzyme K Blocking Peptide
Description Rabbit polyclonal Granzyme K antibody
Gene GZMK
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.