Name | ABAT antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-2609 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | ABAT antibody was raised using the middle region of ABAT corresponding to a region with amino acids YRSKERGQRGFSQEELETCMINQAPGCPDYSILSFMGAFHGRTMGCLATT |
Purity/Format | Affinity purified |
Blocking Peptide | ABAT Blocking Peptide |
Description | Rabbit polyclonal ABAT antibody raised against the middle region of ABAT |
Gene | ABAT |
Supplier Page | Shop |