P2RX2 antibody

Name P2RX2 antibody
Supplier Fitzgerald
Catalog 70R-1518
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Dog
Antigen P2RX2 antibody was raised using the N terminal of P2RX2 corresponding to a region with amino acids QESETGPESSIITKVKGITTSEHKVWDVEEYVKPPEGGSVFSIITRVEAT
Purity/Format Total IgG Protein A purified
Blocking Peptide P2RX2 Blocking Peptide
Description Rabbit polyclonal P2RX2 antibody raised against the N terminal of P2RX2
Gene PRRX2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.