| Name | TMED1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7395 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | TMED1 antibody was raised using the middle region of TMED1 corresponding to a region with amino acids FTLESPQGVLLVSESRKADGVHTVEPTEAGDYKLCFDNSFSTISEKLVFF |
| Purity/Format | Affinity purified |
| Blocking Peptide | TMED1 Blocking Peptide |
| Description | Rabbit polyclonal TMED1 antibody raised against the middle region of TMED1 |
| Gene | IL1RL1 |
| Supplier Page | Shop |