| Name | DCTD antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4083 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | DCTD antibody was raised using the middle region of DCTD corresponding to a region with amino acids MSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKL |
| Purity/Format | Affinity purified |
| Blocking Peptide | DCTD Blocking Peptide |
| Description | Rabbit polyclonal DCTD antibody raised against the middle region of DCTD |
| Gene | DCTD |
| Supplier Page | Shop |