| Name | GCLC antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2993 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | GCLC antibody was raised using the N terminal of GCLC corresponding to a region with amino acids VLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEAN |
| Purity/Format | Affinity purified |
| Blocking Peptide | GCLC Blocking Peptide |
| Description | Rabbit polyclonal GCLC antibody raised against the N terminal of GCLC |
| Gene | GCLC |
| Supplier Page | Shop |