EBP antibody

Name EBP antibody
Supplier Fitzgerald
Catalog 70R-6689
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen EBP antibody was raised using a synthetic peptide corresponding to a region with amino acids LVIEGWFVLYYEDLLGDQAFLSQLWKEYAKGDSRYILGDNFTVCMETITA
Purity/Format Affinity purified
Blocking Peptide EBP Blocking Peptide
Description Rabbit polyclonal EBP antibody
Gene EBP
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.