HEATR4 antibody

Name HEATR4 antibody
Supplier Fitzgerald
Catalog 70R-4280
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen HEATR4 antibody was raised using the N terminal of HEATR4 corresponding to a region with amino acids VFFSSQYRLHRKSQYLKMAAANLTFSQEVVWQRGLPSIPYSQYSFDHLYN
Purity/Format Affinity purified
Blocking Peptide HEATR4 Blocking Peptide
Description Rabbit polyclonal HEATR4 antibody raised against the N terminal of HEATR4
Gene HEATR4
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.