| Name | HNRPA0 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1363 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human |
| Antigen | HNRPA0 antibody was raised using the middle region of HNRPA0 corresponding to a region with amino acids KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | HNRPA0 Blocking Peptide |
| Description | Rabbit polyclonal HNRPA0 antibody raised against the middle region of HNRPA0 |
| Gene | HNRNPA0 |
| Supplier Page | Shop |