| Name | RUNX2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1010 |
| Prices | $315.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | RUNX2 antibody was raised using the middle region of RUNX2 corresponding to a region with amino acids DTATSDFCLWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRM |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | RUNX2 Blocking Peptide |
| Description | Rabbit polyclonal RUNX2 antibody raised against the middle region of RUNX2 |
| Gene | RUNX2 |
| Supplier Page | Shop |