| Name | EPB41 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2838 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Dog |
| Antigen | EPB41 antibody was raised using the N terminal of EPB41 corresponding to a region with amino acids SESRGLSRLFSSFLKRPKSQVSEEEGKEVESDKEKGEGGQKEIEFGTSLD |
| Purity/Format | Affinity purified |
| Blocking Peptide | EPB41 Blocking Peptide |
| Description | Rabbit polyclonal EPB41 antibody raised against the N terminal of EPB41 |
| Gene | EPB41 |
| Supplier Page | Shop |