PPAT antibody

Name PPAT antibody
Supplier Fitzgerald
Catalog 70R-2293
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen PPAT antibody was raised using the C terminal of PPAT corresponding to a region with amino acids QEGIKFKKQKEKKHDIMIQENGNGLECFEKSGHCTACLTGKYPVELEW
Purity/Format Affinity purified
Blocking Peptide PPAT Blocking Peptide
Description Rabbit polyclonal PPAT antibody raised against the C terminal of PPAT
Gene PPAT
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.