ACADS antibody

Name ACADS antibody
Supplier Fitzgerald
Catalog 70R-2485
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen ACADS antibody was raised using the N terminal of ACADS corresponding to a region with amino acids ASTGVIMSVNNSLYLGPILKFGSKEQKQAWVTPFTSGDKIGCFALSEPGN
Purity/Format Affinity purified
Blocking Peptide ACADS Blocking Peptide
Description Rabbit polyclonal ACADS antibody raised against the N terminal of ACADS
Gene ACADS
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.