| Name | SIGLEC9 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6182 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | SIGLEC9 antibody was raised using the C terminal of SIGLEC9 corresponding to a region with amino acids PWVHLRDAAEFTCRAQNPLGSQQVYLNVSLQSKATSGVTQGVVGGAGATA |
| Purity/Format | Affinity purified |
| Blocking Peptide | SIGLEC9 Blocking Peptide |
| Description | Rabbit polyclonal SIGLEC9 antibody raised against the C terminal of SIGLEC9 |
| Gene | SIGLEC9 |
| Supplier Page | Shop |