| Name | TNNI3K antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3960 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | TNNI3K antibody was raised using the N terminal of TNNI3K corresponding to a region with amino acids LLKFGADVNVSGEVGDRPLHLASAKGFLNIAKLLMEEGSKADVNAQDNED |
| Purity/Format | Affinity purified |
| Blocking Peptide | TNNI3K Blocking Peptide |
| Description | Rabbit polyclonal TNNI3K antibody raised against the N terminal of TNNI3K |
| Gene | TNNI3K |
| Supplier Page | Shop |