| Name | C6ORF146 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3608 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C6ORF146 antibody was raised using the middle region of C6Orf146 corresponding to a region with amino acids ETLPAPNWNLKHGNSSVEENFTDESDLSENEKTNDTLLSYFKKVDLNLKP |
| Purity/Format | Affinity purified |
| Blocking Peptide | C6ORF146 Blocking Peptide |
| Description | Rabbit polyclonal C6ORF146 antibody raised against the middle region of C6Orf146 |
| Gene | FAM217A |
| Supplier Page | Shop |