RNF6 antibody

Name RNF6 antibody
Supplier Fitzgerald
Catalog 70R-3063
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen RNF6 antibody was raised using a synthetic peptide corresponding to a region with amino acids VETGTLPILRLAHFFLLNESDDDDRIRGLTKEQIDNLSTRHYEHNSIDSE
Purity/Format Affinity purified
Blocking Peptide RNF6 Blocking Peptide
Description Rabbit polyclonal RNF6 antibody
Gene TRIM31
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.